CDH8 polyclonal antibody
  • CDH8 polyclonal antibody

CDH8 polyclonal antibody

Ref: AB-PAB30492
CDH8 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against partial recombinant human CDH8.
Información adicional
Size 100 uL
Gene Name CDH8
Gene Alias Nbla04261
Gene Description cadherin 8, type 2
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq TLTVTLTDVNDNPPKFAQSLYHFSVPEDVVLGTAIGRVKANDQDIGENAQSSYDIIDGDGTALFEITSDAQAQDGIIRLRKPLDFETKKSYTLKVEAANVHIDPRFSGRGPFKDTAT
Form Liquid
Recomended Dilution Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (1:200-1:500)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to human CDH8.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide).
Gene ID 1006
Iso type IgG

Enviar uma mensagem


CDH8 polyclonal antibody

CDH8 polyclonal antibody