TAC1 polyclonal antibody
  • TAC1 polyclonal antibody

TAC1 polyclonal antibody

Ref: AB-PAB30483
TAC1 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against partial recombinant human TAC1.
Información adicional
Size 100 uL
Gene Name TAC1
Gene Alias Hs.2563|NK2|NKNA|NPK|TAC2
Gene Description tachykinin, precursor 1
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq WSDWYDSDQIKEELPEPFEHLLQRIARRPKPQQFFGLMGKRDADSSIEKQVALLKALYGHGQISHKRHKTDSFVGLMGKRALNSVAYERSAMQNYERRR
Form Liquid
Recomended Dilution Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (1:50-1:200)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to human TAC1.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide).
Gene ID 6863
Iso type IgG

Enviar uma mensagem


TAC1 polyclonal antibody

TAC1 polyclonal antibody