PDCD1LG2 polyclonal antibody
  • PDCD1LG2 polyclonal antibody

PDCD1LG2 polyclonal antibody

Ref: AB-PAB30468
PDCD1LG2 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against partial recombinant human PDCD1LG2.
Información adicional
Size 100 uL
Gene Name PDCD1LG2
Gene Alias B7DC|Btdc|CD273|MGC142238|MGC142240|PD-L2|PDCD1L2|PDL2|bA574F11.2
Gene Description programmed cell death 1 ligand 2
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq GYPLAEVSWPNVSVPANTSHSRTPEGLYQVTSVLRLKPPPGRNFSCVFWNTHVRELTLASIDLQSQMEPRTHPT
Form Liquid
Recomended Dilution Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (1:50-1:200)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to human PDCD1LG2.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide).
Gene ID 80380
Iso type IgG

Enviar uma mensagem


PDCD1LG2 polyclonal antibody

PDCD1LG2 polyclonal antibody