TNK1 polyclonal antibody
  • TNK1 polyclonal antibody

TNK1 polyclonal antibody

Ref: AB-PAB30450
TNK1 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against partial recombinant human TNK1.
Información adicional
Size 100 uL
Gene Name TNK1
Gene Alias MGC46193
Gene Description tyrosine kinase, non-receptor, 1
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq PSEACCVRDVTEPGALRMETGDPITVIEGSPDSTIWKGQNGRTFKVGSFPASAVTLADAGGLPATRPVHRGTPARGDQHPGSIDGDRKKANLWDAPPARGQRRNMPLERMKGISRSLESVLSLG
Form Liquid
Recomended Dilution Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (1:20-1:50)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to human TNK1.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide).
Gene ID 8711
Iso type IgG

Enviar uma mensagem


TNK1 polyclonal antibody

TNK1 polyclonal antibody