KSR1 polyclonal antibody
  • KSR1 polyclonal antibody

KSR1 polyclonal antibody

Ref: AB-PAB30443
KSR1 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against partial recombinant human KSR1.
Información adicional
Size 100 uL
Gene Name KSR1
Gene Alias KSR|RSU2
Gene Description kinase suppressor of ras 1
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq SMIFGVKCKHCRLKCHNKCTKEAPACRISFLPLTRLRRTESVPSDINNPVDRAAEPHFGTLPKALTKKEHPPAMNHLDSSSNPSSTTSSTPSSPAPFPTSSNPSSATTPPNPSPGQRDSRFNFPA
Form Liquid
Recomended Dilution Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (1:20-1:50)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to human KSR1.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide).
Gene ID 8844
Iso type IgG

Enviar uma mensagem


KSR1 polyclonal antibody

KSR1 polyclonal antibody