IL6ST polyclonal antibody
  • IL6ST polyclonal antibody

IL6ST polyclonal antibody

Ref: AB-PAB30433
IL6ST polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against partial recombinant human IL6ST.
Información adicional
Size 100 uL
Gene Name IL6ST
Gene Alias CD130|CDw130|GP130|GP130-RAPS|IL6R-beta
Gene Description interleukin 6 signal transducer (gp130, oncostatin M receptor)
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq CYLITVTPVYADGPGSPESIKAYLKQAPPSKGPTVRTKKVGKNEAVLEWDQLPVDVQNGFIRNYTIFYRTIIGNETAVNVDSSHTEYTLSSLTSDTLYMVRMAAYTDEGGKDGPEFTFTTPKFAQGEI
Form Liquid
Recomended Dilution Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (1:50-1:200)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to human IL6ST.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide).
Gene ID 3572
Iso type IgG

Enviar uma mensagem


IL6ST polyclonal antibody

IL6ST polyclonal antibody