DLG4 polyclonal antibody
  • DLG4 polyclonal antibody

DLG4 polyclonal antibody

Ref: AB-PAB30431
DLG4 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against partial recombinant human DLG4.
Información adicional
Size 100 uL
Gene Name DLG4
Gene Alias FLJ97752|FLJ98574|PSD95|SAP-90|SAP90
Gene Description discs, large homolog 4 (Drosophila)
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq HDLREQLMNSSLGSGTASLRSNPKRGFYIRALFDYDKTKDCGFLSQALSFRFGDVLHVIDASDEEWWQARRVHSDSETDDIGFIPSKRRVERREWSRLKAKDWGSSSGSQGREDSVLSYETVTQMEVHYAR
Form Liquid
Recomended Dilution Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (1:200-1:500)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to human DLG4.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide).
Gene ID 1742
Iso type IgG

Enviar uma mensagem


DLG4 polyclonal antibody

DLG4 polyclonal antibody