DLG4 polyclonal antibody View larger

Rabbit polyclonal antibody raised against partial recombinant human DLG4.

AB-PAB30431

New product

DLG4 polyclonal antibody

More details

Registe-se for viewing this price!

Ao comprar este produto pode ganhar até 6 pontos de fidelização. Seu carrinho totalizará 6 pontos de fidelização que podem ser convertidos num vale de desconto de 24.00EUR.


Data sheet

Size 100 uL
Gene Name DLG4
Gene Alias FLJ97752|FLJ98574|PSD95|SAP-90|SAP90
Gene Description discs, large homolog 4 (Drosophila)
Storage Conditions Store at 4ºC. For long term storage store at -20ºC.<br>Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq HDLREQLMNSSLGSGTASLRSNPKRGFYIRALFDYDKTKDCGFLSQALSFRFGDVLHVIDASDEEWWQARRVHSDSETDDIGFIPSKRRVERREWSRLKAKDWGSSSGSQGREDSVLSYETVTQMEVHYAR
Form Liquid
Recomended Dilution Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (1:200-1:500)<br>The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to human DLG4.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide).
Gene ID 1742
Iso type IgG

More info

Rabbit polyclonal antibody raised against partial recombinant human DLG4.

Enviar uma mensagem

Rabbit polyclonal antibody raised against partial recombinant human DLG4.

Rabbit polyclonal antibody raised against partial recombinant human DLG4.