GALNT10 polyclonal antibody
  • GALNT10 polyclonal antibody

GALNT10 polyclonal antibody

Ref: AB-PAB30413
GALNT10 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against partial recombinant human GALNT10.
Información adicional
Size 100 uL
Gene Name GALNT10
Gene Alias DKFZp586H0623|FLJ00205|FLJ11715|GalNAcT10|pp-GalNAc-T10
Gene Description UDP-N-acetyl-alpha-D-galactosamine:polypeptide N-acetylgalactosaminyltransferase 10 (GalNAc-T10)
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq AGQGSHSRQKKTFFLGDGQKLKDWHDKEAIRRDAQRVGNGEQGRPYPMTDAERVDQAYRENGFNIYVSDKISLNRSLPDIRHPNCNSKRYLETLPNTSIIIPFHNEGWSSLLRTVHSVLNRS
Form Liquid
Recomended Dilution Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (1:200-1:500)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to human GALNT10.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide).
Gene ID 55568
Iso type IgG

Enviar uma mensagem


GALNT10 polyclonal antibody

GALNT10 polyclonal antibody