MARK1 polyclonal antibody
  • MARK1 polyclonal antibody

MARK1 polyclonal antibody

Ref: AB-PAB30411
MARK1 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against partial recombinant human MARK1.
Información adicional
Size 100 uL
Gene Name MARK1
Gene Alias KIAA1477|MARK|MGC126512|MGC126513
Gene Description MAP/microtubule affinity-regulating kinase 1
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq MSTSGHPIKVTLPTIKDGSEAYRPGTTQRVPAASPSAHSISTATPDRTRFPRGSSSRSTFHGEQLRERRSVAYNGPPASPSHETGAFAHARRGTSTGIISKIT
Form Liquid
Recomended Dilution Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (1:20-1:50)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to human MARK1.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide).
Gene ID 4139
Iso type IgG

Enviar uma mensagem


MARK1 polyclonal antibody

MARK1 polyclonal antibody