CC2D1A polyclonal antibody
  • CC2D1A polyclonal antibody

CC2D1A polyclonal antibody

Ref: AB-PAB30390
CC2D1A polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against partial recombinant human CC2D1A.
Información adicional
Size 100 uL
Gene Name CC2D1A
Gene Alias FLJ20241|FLJ41160|FREUD-1|Freud-1/Aki1|MRT3
Gene Description coiled-coil and C2 domain containing 1A
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq NLLASIRKGNAIDEADIPPPVAIGKGPASTPTYSPAPTQPAPRIASAPEPRVTLEGPSATAPASSPGLAKPQMPPGPCSPGPLAQLQSRQRDYKLAALHAKQQGDTTAAARHFRVAKSFDAVLE
Form Liquid
Recomended Dilution Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (1:50-1:200)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to human CC2D1A.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide).
Gene ID 54862
Iso type IgG

Enviar uma mensagem


CC2D1A polyclonal antibody

CC2D1A polyclonal antibody