REN polyclonal antibody
  • REN polyclonal antibody

REN polyclonal antibody

Ref: AB-PAB30388
REN polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against partial recombinant human REN.
Información adicional
Size 100 uL
Gene Name REN
Gene Alias FLJ10761
Gene Description renin
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq FHYINLIKTGVWQIQMKGVSVGSSTLLCEDGCLALVDTGASYISGSTSSIEKLMEALGAKKRLFDYVVKCNEGPTLPDISFHLGGKEYTLTSADYVFQESYSSKKLCTLAIHAMDIPPPTGPTWALGATFIRKFYTEFD
Form Liquid
Recomended Dilution Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (1:50-1:200)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to human REN.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide).
Gene ID 5972
Iso type IgG

Enviar uma mensagem


REN polyclonal antibody

REN polyclonal antibody