SEMA5A polyclonal antibody
  • SEMA5A polyclonal antibody

SEMA5A polyclonal antibody

Ref: AB-PAB30375
SEMA5A polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against partial recombinant human SEMA5A.
Información adicional
Size 100 uL
Gene Name SEMA5A
Gene Alias FLJ12815|SEMAF|semF
Gene Description sema domain, seven thrombospondin repeats (type 1 and type 1-like), transmembrane domain (TM) and short cytoplasmic domain, (semaphorin) 5A
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq PWTKCSATCGGGHYMRTRSCSNPAPAYGGDICLGLHTEEALCNTQPCPESWSEWSDWSECEASGVQVRARQCILLFPMGSQCSGNTTESRPCVFDSNFIPEVSVARSSSVEEKRCGE
Form Liquid
Recomended Dilution Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (1:20-1:50)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to human SEMA5A.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide).
Gene ID 9037
Iso type IgG

Enviar uma mensagem


SEMA5A polyclonal antibody

SEMA5A polyclonal antibody