MAGEC1 polyclonal antibody
  • MAGEC1 polyclonal antibody

MAGEC1 polyclonal antibody

Ref: AB-PAB30374
MAGEC1 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against partial recombinant human MAGEC1.
Información adicional
Size 100 uL
Gene Name MAGEC1
Gene Alias CT7|MAGE-C1|MGC39366
Gene Description melanoma antigen family C, 1
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq QIPQSSPEGDDTQSPLQNSQSSPEGKDSLSPLEISQSPPEGEDVQSPLQNPASSFFSSALLSIFQSSPESTQSPFEGFPQSVLQIPVSAASSSTLVSIFQ
Form Liquid
Recomended Dilution Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (1:50-1:200)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to human MAGEC1.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide).
Gene ID 9947
Iso type IgG

Enviar uma mensagem


MAGEC1 polyclonal antibody

MAGEC1 polyclonal antibody