SLC30A9 polyclonal antibody
  • SLC30A9 polyclonal antibody

SLC30A9 polyclonal antibody

Ref: AB-PAB30365
SLC30A9 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against partial recombinant human SLC30A9.
Información adicional
Size 100 uL
Gene Name SLC30A9
Gene Alias C4orf1|GAC63|HUEL|ZNT9
Gene Description solute carrier family 30 (zinc transporter), member 9
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq HRCSWSSLCRLRLRCRAAACNPSDRQEWQNLVTFGSFSNVVPCSHPYIGTLSQVKLYSTNVQKEGQGSQTLRVEKVPSFETAEGIGAELKAPLKQEPLQVRVKAVLKKREYGSKYTQNNFITGV
Form Liquid
Recomended Dilution Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (1:50-1:200)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to human SLC30A9.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide).
Gene ID 10463
Iso type IgG

Enviar uma mensagem


SLC30A9 polyclonal antibody

SLC30A9 polyclonal antibody