PPFIBP2 polyclonal antibody
  • PPFIBP2 polyclonal antibody

PPFIBP2 polyclonal antibody

Ref: AB-PAB30362
PPFIBP2 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against partial recombinant human PPFIBP2.
Información adicional
Size 100 uL
Gene Name PPFIBP2
Gene Alias Cclp1|DKFZp781K06126|MGC42541
Gene Description PTPRF interacting protein, binding protein 2 (liprin beta 2)
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq TAALHSESHTERDQEIQRLKMGMETLLLANEDKDRRIEELTGLLNQYRKVKEIVMVTQGPSERTLSINEEEPEGGFSKWNATNKDPEELFKQEMPPRCSSPTVGPPPLPQKSLETRAQK
Form Liquid
Recomended Dilution Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (1:50-1:200)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to human PPFIBP2.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide).
Gene ID 8495
Iso type IgG

Enviar uma mensagem


PPFIBP2 polyclonal antibody

PPFIBP2 polyclonal antibody