RNASE11 polyclonal antibody
  • RNASE11 polyclonal antibody

RNASE11 polyclonal antibody

Ref: AB-PAB30353
RNASE11 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against partial recombinant human RNASE11.
Información adicional
Size 100 uL
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq TSLSMSKDDMSSTLLTFRSLHYNDPKGNSSGNDKECCNDMTVWRKVSEANGSCKWSNNFIRSSTEVMRRVHRAPSCKFVQNPGISCCESLELENTVCQFTTGKQFPRCQYHSVTSLEKILTVLTGHSLMSWL
Form Liquid
Recomended Dilution Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (1:50-1:200)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to human RNASE11.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide).
Iso type IgG

Enviar uma mensagem


RNASE11 polyclonal antibody

RNASE11 polyclonal antibody