GPR143 polyclonal antibody
  • GPR143 polyclonal antibody

GPR143 polyclonal antibody

Ref: AB-PAB30351
GPR143 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against partial recombinant human GPR143.
Información adicional
Size 100 uL
Gene Name GPR143
Gene Alias OA1
Gene Description G protein-coupled receptor 143
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq CSLGFQSPRKEIQWESLTTSAAEGAHPSPLMPHENPASGKVSQVGGQTSDEALSMLSEGSDASTIEIHTASESCNKNEGDPALPT
Form Liquid
Recomended Dilution Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (1:200-1:500)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to human GPR143.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide).
Gene ID 4935
Iso type IgG

Enviar uma mensagem


GPR143 polyclonal antibody

GPR143 polyclonal antibody