NDRG2 polyclonal antibody
  • NDRG2 polyclonal antibody

NDRG2 polyclonal antibody

Ref: AB-PAB30347
NDRG2 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against partial recombinant human NDRG2.
Información adicional
Size 100 uL
Gene Name NDRG2
Gene Alias DKFZp781G1938|FLJ25522|KIAA1248|SYLD
Gene Description NDRG family member 2
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq THSVETPYGSVTFTVYGTPKPKRPAILTYHDVGLNYKSCFQPLFQFEDMQEIIQNFVRVHVDAPGMEEGAPVFPLGYQYPSLDQLADMIPCVLQYLNFSTIIGVGVGAGA
Form Liquid
Recomended Dilution Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (1:50-1:200)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to human NDRG2.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide).
Gene ID 57447
Iso type IgG

Enviar uma mensagem


NDRG2 polyclonal antibody

NDRG2 polyclonal antibody