FSCB polyclonal antibody
  • FSCB polyclonal antibody

FSCB polyclonal antibody

Ref: AB-PAB30345
FSCB polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against partial recombinant human FSCB.
Información adicional
Size 100 uL
Gene Name FSCB
Gene Alias C14orf155|DKFZp434F1017|DKFZp686A1639|DKFZp686J0539
Gene Description fibrous sheath CABYR binding protein
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq ADLLLTEEFPIGEASAEVSPPPSEQTPEDEALVENVSTEFQSPQVAGIPAVKLGSVVLEGEAKFEEVSKINSVLKDLSNTNDGQAPT
Form Liquid
Recomended Dilution Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (1:200-1:500)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to human FSCB.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide).
Gene ID 84075
Iso type IgG

Enviar uma mensagem


FSCB polyclonal antibody

FSCB polyclonal antibody