CHL1 polyclonal antibody
  • CHL1 polyclonal antibody

CHL1 polyclonal antibody

Ref: AB-PAB30337
CHL1 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against partial recombinant human CHL1.
Información adicional
Size 100 uL
Gene Name CHL1
Gene Alias CALL|FLJ44930|L1CAM2|MGC132578
Gene Description cell adhesion molecule with homology to L1CAM (close homolog of L1)
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq CEFFASPEAVVSWQKVEEVKPLEGRRYHIYENGTLQINRTTEEDAGSYSCWVENAIGKTAVTANLDIRNATKLRVSPKNPRIPKLHMLELHCESKCDSHLKHSLKLSWSKDGEAFEINGTEDGRIIIDGANLTISNVTLEDQGIYCCS
Form Liquid
Recomended Dilution Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (1:200-1:500)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to human CHL1.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide).
Gene ID 10752
Iso type IgG

Enviar uma mensagem


CHL1 polyclonal antibody

CHL1 polyclonal antibody