USP11 polyclonal antibody
  • USP11 polyclonal antibody

USP11 polyclonal antibody

Ref: AB-PAB30334
USP11 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against partial recombinant human USP11.
Información adicional
Size 100 uL
Gene Name USP11
Gene Alias UHX1
Gene Description ubiquitin specific peptidase 11
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq ESGRERPLRAGESWFLVEKHWYKQWEAYVQGGDQDSSTFPGCINNATLFQDEINWRLKEGLVEGEDYVLLPAAAWHYLVSWYGLEHGQPPIERKVIELPNIQKVEVYPVELLLVRHNDLGKSHTVQFS
Form Liquid
Recomended Dilution Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (1:50-1:200)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to human USP11.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide).
Gene ID 8237
Iso type IgG

Enviar uma mensagem


USP11 polyclonal antibody

USP11 polyclonal antibody