TM4SF1 polyclonal antibody
  • TM4SF1 polyclonal antibody

TM4SF1 polyclonal antibody

Ref: AB-PAB30331
TM4SF1 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against partial recombinant human TM4SF1.
Información adicional
Size 100 uL
Gene Name TM4SF1
Gene Alias H-L6|L6|M3S1|TAAL6
Gene Description transmembrane 4 L six family member 1
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq GPLCLDSLGQWNYTFASTEGQYLLDTSTWSECTEPKHIVEWNVSLFSI
Form Liquid
Recomended Dilution Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (1:500-1:1000)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to human TM4SF1.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide).
Gene ID 4071
Iso type IgG

Enviar uma mensagem


TM4SF1 polyclonal antibody

TM4SF1 polyclonal antibody