NFKBIE polyclonal antibody
  • NFKBIE polyclonal antibody

NFKBIE polyclonal antibody

Ref: AB-PAB30327
NFKBIE polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against partial recombinant human NFKBIE.
Información adicional
Size 100 uL
Gene Name NFKBIE
Gene Alias IKBE
Gene Description nuclear factor of kappa light polypeptide gene enhancer in B-cells inhibitor, epsilon
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq PEPGRGTSHSLDLQLQNWQGLACLHIATLQKNQPLMELLLRNGADIDVQEGTSGKTALHLAVETQERGLVQFLLQAGAQVDARMLNGCTPLHLAAGRGLMGISSTLCKAGADSLLRNVEDETPQDLTEESLVLLPFDDLKI
Form Liquid
Recomended Dilution Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (1:50-1:200)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to human NFKBIE.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide).
Gene ID 4794
Iso type IgG

Enviar uma mensagem


NFKBIE polyclonal antibody

NFKBIE polyclonal antibody