ITGB5 polyclonal antibody
  • ITGB5 polyclonal antibody

ITGB5 polyclonal antibody

Ref: AB-PAB30319
ITGB5 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against partial recombinant human ITGB5.
Información adicional
Size 100 uL
Gene Name ITGB5
Gene Alias FLJ26658
Gene Description integrin, beta 5
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq KCHAGYIGDNCNCSTDISTCRGRDGQICSERGHCLCGQCQCTEPGAFGEMCEKCPTCPDACSTKRDCVECLLLHSGKPDNQTCHSLCRDEVITWVDTIVKDDQEAVLCFYKTAKDCVMMFTYVELPSGKSNLTVL
Form Liquid
Recomended Dilution Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (1:50-1:200)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to human ITGB5.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide).
Gene ID 3693
Iso type IgG

Enviar uma mensagem


ITGB5 polyclonal antibody

ITGB5 polyclonal antibody