PTGS2 polyclonal antibody
  • PTGS2 polyclonal antibody

PTGS2 polyclonal antibody

Ref: AB-PAB30313
PTGS2 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against partial recombinant human PTGS2.
Información adicional
Size 100 uL
Gene Name PTGS2
Gene Alias COX-2|COX2|GRIPGHS|PGG/HS|PGHS-2|PHS-2|hCox-2
Gene Description prostaglandin-endoperoxide synthase 2 (prostaglandin G/H synthase and cyclooxygenase)
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq RQMKYQSFNEYRKRFMLKPYESFEELTGEKEMSAELEALYGDIDAVELYPALLVEKPRPDAIFGETMVEVGAPFSLKGLMGNVICSPAYWKPSTFGGEVGFQIINTASIQSLICNNVKGCPFTSFSVPDPE
Form Liquid
Recomended Dilution Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (1:200-1:500)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to human PTGS2.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide).
Gene ID 5743
Iso type IgG

Enviar uma mensagem


PTGS2 polyclonal antibody

PTGS2 polyclonal antibody