PIGA polyclonal antibody
  • PIGA polyclonal antibody

PIGA polyclonal antibody

Ref: AB-PAB30310
PIGA polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against partial recombinant human PIGA.
Información adicional
Size 100 uL
Gene Name PIGA
Gene Alias GPI3|PIG-A
Gene Description phosphatidylinositol glycan anchor biosynthesis, class A
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq FADVSSVLTNKLLTVSLCDTNHIICVSYTSKENTVLRAALNPEIVSVIPNAVDPTDFTPDPFRRHDSITIVVVSRLVYRKGIDLLSGIIPELCQKYPDLNFIIGGEGPKRII
Form Liquid
Recomended Dilution Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (1:200-1:500)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to human PIGA.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide).
Gene ID 5277
Iso type IgG

Enviar uma mensagem


PIGA polyclonal antibody

PIGA polyclonal antibody