View larger
Rabbit polyclonal antibody raised against partial recombinant human ITGA2.
AB-PAB30299
New product
ITGA2 polyclonal antibody
Ao comprar este produto pode ganhar até 4 pontos de fidelização. Seu carrinho totalizará 4 pontos de fidelização que podem ser convertidos num vale de desconto de 16.00EUR.
Data sheet
| Size | 100 uL |
| Gene Name | ITGA2 |
| Gene Alias | BR|CD49B|GPIa|VLA-2|VLAA2 |
| Gene Description | integrin, alpha 2 (CD49B, alpha 2 subunit of VLA-2 receptor) |
| Storage Conditions | Store at 4ºC for short term storage. For long term storage store at -20ºC.<br>Aliquot to avoid repeated freezing and thawing. |
| Application Key | IHC-P |
| Immunogen Prot. Seq | SSSVSFKSENFRHTKELNCRTASCSNVTCWLKDVHMKGEYFVNVTTRIWNGTFASSTFQTVQLTAAAEINTYNPEIYVIEDNTVTIPLMIMKPDE |
| Form | Liquid |
| Recomended Dilution | Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (1:20 - 1:50)<br>The optimal working dilution should be determined by the end user. |
| Antigen species Target species | Human |
| Immunogen | Recombinant protein corresponding to amino acids 1032-1126 of human ITGA2. |
| Storage Buffer | In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide). |
| Gene ID | 3673 |
| Iso type | IgG |
More info
Rabbit polyclonal antibody raised against partial recombinant human ITGA2.