ITGA2 polyclonal antibody
  • ITGA2 polyclonal antibody

ITGA2 polyclonal antibody

Ref: AB-PAB30299
ITGA2 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against partial recombinant human ITGA2.
Información adicional
Size 100 uL
Gene Name ITGA2
Gene Alias BR|CD49B|GPIa|VLA-2|VLAA2
Gene Description integrin, alpha 2 (CD49B, alpha 2 subunit of VLA-2 receptor)
Storage Conditions Store at 4C for short term storage. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq SSSVSFKSENFRHTKELNCRTASCSNVTCWLKDVHMKGEYFVNVTTRIWNGTFASSTFQTVQLTAAAEINTYNPEIYVIEDNTVTIPLMIMKPDE
Form Liquid
Recomended Dilution Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (1:20 - 1:50)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids 1032-1126 of human ITGA2.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide).
Gene ID 3673
Iso type IgG

Enviar uma mensagem


ITGA2 polyclonal antibody

ITGA2 polyclonal antibody