CD1E polyclonal antibody
  • CD1E polyclonal antibody

CD1E polyclonal antibody

Ref: AB-PAB30295
CD1E polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against partial recombinant human CD1E.
Información adicional
Size 100 uL
Gene Name CD1E
Gene Alias CD1A|R2
Gene Description CD1e molecule
Storage Conditions Store at 4C for short term storage. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,IHC-P
Immunogen Prot. Seq PWSHGNFSKQELKNLQSLFQLYFHSFIRIVQASAGQFQLEYPFEIQILAGCRMNAPQIFLNMAYQGSDF
Form Liquid
Recomended Dilution Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (1:20 - 1:50)
Western Blot (1:100 - 1:250)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids 79-147 of human CD1E.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide).
Gene ID 913
Iso type IgG

Enviar uma mensagem


CD1E polyclonal antibody

CD1E polyclonal antibody