TNFSF10 polyclonal antibody
  • TNFSF10 polyclonal antibody

TNFSF10 polyclonal antibody

Ref: AB-PAB30288
TNFSF10 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against partial recombinant human TNFSF10.
Información adicional
Size 100 uL
Gene Name TNFSF10
Gene Alias APO2L|Apo-2L|CD253|TL2|TRAIL
Gene Description tumor necrosis factor (ligand) superfamily, member 10
Storage Conditions Store at 4C for short term storage. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq GLYSIYQGGIFELKENDRIFVSVTNEHLIDMDHEAS
Form Liquid
Recomended Dilution Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (1:200 - 1:500)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids 238-273 of human TNFSF10.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide).
Gene ID 8743
Iso type IgG

Enviar uma mensagem


TNFSF10 polyclonal antibody

TNFSF10 polyclonal antibody