SIGLEC1 polyclonal antibody
  • SIGLEC1 polyclonal antibody

SIGLEC1 polyclonal antibody

Ref: AB-PAB30284
SIGLEC1 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against partial recombinant human SIGLEC1.
Información adicional
Size 100 uL
Gene Name SIGLEC1
Gene Alias CD169|DKFZp667F058|FLJ00051|FLJ00055|FLJ00073|FLJ00411|FLJ32150|SIGLEC-1|SN|dJ1009E24.1
Gene Description sialic acid binding Ig-like lectin 1, sialoadhesin
Storage Conditions Store at 4C for short term storage. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB,IHC-P
Immunogen Prot. Seq CTAQNLLGSISTIGRLQVEGARVVAEPGLDVPEGAALNLSCRLLGGPGPVGNSTFAWFWNDRRLHAEPVPTLAFTHVARAQAGMYH
Form Liquid
Recomended Dilution Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (1:200 - 1:500)
Western Blot (1:500 - 1:1000)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids 1425-1510 of human SIGLEC1.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide).
Gene ID 6614
Iso type IgG

Enviar uma mensagem


SIGLEC1 polyclonal antibody

SIGLEC1 polyclonal antibody