CR2 polyclonal antibody
  • CR2 polyclonal antibody

CR2 polyclonal antibody

Ref: AB-PAB30283
CR2 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against partial recombinant human CR2.
Información adicional
Size 100 uL
Gene Name CR2
Gene Alias C3DR|CD21|SLEB9
Gene Description complement component (3d/Epstein Barr virus) receptor 2
Storage Conditions Store at 4C for short term storage. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq RLPTCVSVFPLECPALPMIHNGHHTSENVGSIAPGLSVTYSCESGYLLVGEKIINCLSSGKWSAVPPTCEEARCKSLGRFPNGKVKEPPILRVGVTANF
Form Liquid
Recomended Dilution Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (1:500 - 1:1000)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids 142-240 of human CR2.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide).
Gene ID 1380
Iso type IgG

Enviar uma mensagem


CR2 polyclonal antibody

CR2 polyclonal antibody