ART1 polyclonal antibody
  • ART1 polyclonal antibody

ART1 polyclonal antibody

Ref: AB-PAB30277
ART1 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against partial recombinant human ART1.
Información adicional
Size 100 uL
Gene Name ART1
Gene Alias ART2|CD296|MGC133217|RT6
Gene Description ADP-ribosyltransferase 1
Storage Conditions Store at 4C for short term storage. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq IQLDMALASFDDQYAGCAAAMTAALPDLNHTEFQANQVYADSWTLASSQWQERQARWPEWSLSPTRPSPPPLGFRDEHGVALLAYT
Form Liquid
Recomended Dilution Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (1:200 - 1:500)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids 37-122 of human ART1.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide).
Gene ID 417
Iso type IgG

Enviar uma mensagem


ART1 polyclonal antibody

ART1 polyclonal antibody