LY9 polyclonal antibody
  • LY9 polyclonal antibody

LY9 polyclonal antibody

Ref: AB-PAB30276
LY9 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against partial recombinant human LY9.
Información adicional
Size 100 uL
Gene Name LY9
Gene Alias CD229|SLAMF3|hly9|mLY9
Gene Description lymphocyte antigen 9
Storage Conditions Store at 4C for short term storage. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,IHC-P
Immunogen Prot. Seq KRKGRCSVPAFCSSQAEAPADTPEPTAGHTLYSVLSQGYEKLDTPLRPARQQPTPTSDSSSDSNLTTEEDEDRPEVHKPISGRYE
Form Liquid
Recomended Dilution Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (1:1000 - 1:2500)
Western Blot (1:1000 - 1:2500)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids 477-561 of human LY9.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide).
Gene ID 4063
Iso type IgG

Enviar uma mensagem


LY9 polyclonal antibody

LY9 polyclonal antibody