PLAUR polyclonal antibody
  • PLAUR polyclonal antibody

PLAUR polyclonal antibody

Ref: AB-PAB30275
PLAUR polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against partial recombinant human PLAUR.
Información adicional
Size 100 uL
Gene Name PLAUR
Gene Alias CD87|UPAR|URKR
Gene Description plasminogen activator, urokinase receptor
Storage Conditions Store at 4C for short term storage. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq VRLWEEGEELELVEKSCTHSEKTNRTLSYRTGLKITSLTEVVCGLDLCNQGNSGRAVTYSRSRYLECISCGSSDMSCERGRHQSLQCRSPEEQCLDVVTHWIQEGE
Form Liquid
Recomended Dilution Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (1:20 - 1:50)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids 51-156 of human PLAUR.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide).
Gene ID 5329
Iso type IgG

Enviar uma mensagem


PLAUR polyclonal antibody

PLAUR polyclonal antibody