BST1 polyclonal antibody
  • BST1 polyclonal antibody

BST1 polyclonal antibody

Ref: AB-PAB30272
BST1 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against partial recombinant human BST1.
Información adicional
Size 100 uL
Gene Name BST1
Gene Alias CD157
Gene Description bone marrow stromal cell antigen 1
Storage Conditions Store at 4C for short term storage. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq EGTSAHLRDIFLGRCAEYRALLSPEQRNKNCTAIWEAFKVALDKDPCSVLPSDYDLFINLSRHSIPRDKSLFWE
Form Liquid
Recomended Dilution Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (1:50 - 1:200)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids 37-110 of human BST1.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide).
Gene ID 683
Iso type IgG

Enviar uma mensagem


BST1 polyclonal antibody

BST1 polyclonal antibody