TLR4 polyclonal antibody
  • TLR4 polyclonal antibody

TLR4 polyclonal antibody

Ref: AB-PAB30269
TLR4 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against partial recombinant human TLR4.
Información adicional
Size 100 uL
Gene Name TLR4
Gene Alias ARMD10|CD284|TOLL|hToll
Gene Description toll-like receptor 4
Storage Conditions Store at 4C for short term storage. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq LQVLNMSHNNFFSLDTFPYKCLNSLQVLDYSLNHIMTSKKQELQHFPSSLAFLNLTQNDFACTCEHQSFLQWIKDQRQLLVEVERMECATP
Form Liquid
Recomended Dilution Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (1:50 - 1:200)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids 522-612 of human TLR4.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide).
Gene ID 7099
Iso type IgG

Enviar uma mensagem


TLR4 polyclonal antibody

TLR4 polyclonal antibody