ATP1B3 polyclonal antibody
  • ATP1B3 polyclonal antibody

ATP1B3 polyclonal antibody

Ref: AB-PAB30267
ATP1B3 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against partial recombinant human ATP1B3.
Información adicional
Size 100 uL
Gene Name ATP1B3
Gene Alias ATPB-3|CD298|FLJ29027
Gene Description ATPase, Na+/K+ transporting, beta 3 polypeptide
Storage Conditions Store at 4C for short term storage. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq KPYTLEEQKNLTVCPDGALFEQKGPVYVACQFPISLLQACSGMNDPDFGYSQGNPCIL
Form Liquid
Recomended Dilution Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (1:200 - 1:500)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids 115-172 of human ATP1B3.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide).
Gene ID 483
Iso type IgG

Enviar uma mensagem


ATP1B3 polyclonal antibody

ATP1B3 polyclonal antibody