SIRPB1 polyclonal antibody
  • SIRPB1 polyclonal antibody

SIRPB1 polyclonal antibody

Ref: AB-PAB30263
SIRPB1 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against partial recombinant human SIRPB1.
Información adicional
Size 100 uL
Gene Name SIRPB1
Gene Alias CD172b|DKFZp686A05192|FLJ26614|SIRP-BETA-1
Gene Description signal-regulatory protein beta 1
Storage Conditions Store at 4C for short term storage. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq VSKSYALEISAHQKEHGSDITHEPALAPTAPL
Form Liquid
Recomended Dilution Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (1:200 - 1:500)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids 340-371 of human SIRPB1.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide).
Gene ID 10326
Iso type IgG

Enviar uma mensagem


SIRPB1 polyclonal antibody

SIRPB1 polyclonal antibody