HSPB1 polyclonal antibody
  • HSPB1 polyclonal antibody

HSPB1 polyclonal antibody

Ref: AB-PAB30258
HSPB1 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant human HSPB1.
Información adicional
Size 100 uL
Gene Name HSPB1
Gene Alias CMT2F|DKFZp586P1322|HMN2B|HS.76067|HSP27|HSP28|Hsp25|SRP27
Gene Description heat shock 27kDa protein 1
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ti,IHC-P
Immunogen Prot. Seq EEWSQWLGGSSWPGYVRPLPPAAIESPAVAAPAYSRALSRQLSSGVSEIRHTADRWRVSLDVNHFAPDELTVKTKDGVVEITGKHEERQDEHGYISRCFTRKYTLPPGVDPTQVSS
Form Liquid
Recomended Dilution Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (1:50-1:200)
Western Blot (1:250-1:500)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human HSPB1.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 3315
Iso type IgG

Enviar uma mensagem


HSPB1 polyclonal antibody

HSPB1 polyclonal antibody