ESR1 polyclonal antibody
  • ESR1 polyclonal antibody

ESR1 polyclonal antibody

Ref: AB-PAB30256
ESR1 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant human ESR1.
Información adicional
Size 100 uL
Gene Name ESR1
Gene Alias DKFZp686N23123|ER|ESR|ESRA|Era|NR3A1
Gene Description estrogen receptor 1
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ti,IHC-P
Immunogen Prot. Seq FGSNGLGGFPPLNSVSPSPLMLLHPPPQLSPFLQPHGQQVPYYLENEPSGYTVREAGPPAFYRPNSDNRRQGGRERLASTNDKGSMAMESAKETRYCAVCNDYASGYHYGVWSCEGCKAFFKRSIQGHNDYMCPATNQCTID
Form Liquid
Recomended Dilution Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (1:200-1:500)
Western Blot (1:100-1:250)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human ESR1.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 2099
Iso type IgG

Enviar uma mensagem


ESR1 polyclonal antibody

ESR1 polyclonal antibody