PTPRC polyclonal antibody
  • PTPRC polyclonal antibody

PTPRC polyclonal antibody

Ref: AB-PAB30255
PTPRC polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant human PTPRC.
Información adicional
Size 100 uL
Gene Name PTPRC
Gene Alias B220|CD45|CD45R|GP180|LCA|LY5|T200
Gene Description protein tyrosine phosphatase, receptor type, C
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ti,IHC-P
Immunogen Prot. Seq KLENLEPEHEYKCDSEILYNNHKFTNASKIIKTDFGSPGEPQIIFCRSEAAHQGVITWNPPQRSFHNFTLCYIKETEKDCLNLDKNLIKYDLQNLKPYTKYVLSLHAYIIAKVQRNGSAAMCHFTTKSAPPSQVWNMT
Form Liquid
Recomended Dilution Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (1:500-1:1000)
Western Blot (1:100-1:250)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human PTPRC.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 5788
Iso type IgG

Enviar uma mensagem


PTPRC polyclonal antibody

PTPRC polyclonal antibody