MSR1 polyclonal antibody
  • MSR1 polyclonal antibody

MSR1 polyclonal antibody

Ref: AB-PAB30252
MSR1 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant human MSR1.
Información adicional
Size 100 uL
Gene Name MSR1
Gene Alias CD204|SCARA1|SR-A|phSR1|phSR2
Gene Description macrophage scavenger receptor 1
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,IHC-P
Immunogen Prot. Seq KWETKNCSVSSTNANDITQSLTGKGNDSEEEMRFQEVFMEHMSNMEKRIQHILDMEANLMDTEHFQNFSMTTDQRFNDILLQLSTLFSSVQGHGNAIDEISKSLISLNTTLLDLQLNIENL
Form Liquid
Recomended Dilution Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (1:50-1:200)
Western Blot (1:250-1:500)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human MSR1.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 4481
Iso type IgG

Enviar uma mensagem


MSR1 polyclonal antibody

MSR1 polyclonal antibody