MCM5 polyclonal antibody
  • MCM5 polyclonal antibody

MCM5 polyclonal antibody

Ref: AB-PAB30248
MCM5 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant human MCM5.
Información adicional
Size 100 uL
Gene Name MCM5
Gene Alias CDC46|MGC5315|P1-CDC46
Gene Description minichromosome maintenance complex component 5
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,IHC-P
Immunogen Prot. Seq NRYIIMRSGARQHERDSDRRSSIPITVRQLEAIVRIAEALSKMKLQPFATEADVEEALRLFQVSTLDAALSGTLSGVEGFTSQEDQEMLSRIEKQLKRRFAIGSQVSEHSIIKDFTKQKYPEHAIHKVLQLMLRRGEIQHRMQRKVLY
Form Liquid
Recomended Dilution Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (1:500-1:1000)
Western Blot (1:100-1:250)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human MCM5.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 4174
Iso type IgG

Enviar uma mensagem


MCM5 polyclonal antibody

MCM5 polyclonal antibody