KLK3 polyclonal antibody
  • KLK3 polyclonal antibody

KLK3 polyclonal antibody

Ref: AB-PAB30246
KLK3 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant human KLK3.
Información adicional
Size 100 uL
Gene Name KLK3
Gene Alias APS|KLK2A1|PSA|hK3
Gene Description kallikrein-related peptidase 3
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq SHSFPHPLYDMSLLKNRFLRPGDDSSHDLMLLRLSEPAELTDAVKVMDLPTQEPALGTTCYASGWGSIEPEEFLTPKKLQCVDLHVISNDVCAQVHPQKVTKFMLCAGRWTGGKSTCSGDSGGPLVCNGVLQGITSWGSEPCA
Form Liquid
Recomended Dilution Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (1:2500-1:5000)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human KLK3.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 354
Iso type IgG

Enviar uma mensagem


KLK3 polyclonal antibody

KLK3 polyclonal antibody