DICER1 polyclonal antibody
  • DICER1 polyclonal antibody

DICER1 polyclonal antibody

Ref: AB-PAB30244
DICER1 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant human DICER1.
Información adicional
Size 100 uL
Gene Name DICER1
Gene Alias DCR1|Dicer|HERNA|KIAA0928
Gene Description dicer 1, ribonuclease type III
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq PTDADSAYCVLPLNVVNDSSTLDIDFKFMEDIEKSEARIGIPSTKYTKETPFVFKLEDYQDAVIIPRYRNFDQPHRFYVADVYTDLTPLSKFPSPEYETFAEYYKTKYNLDLTNLNQPLLDVDHTSSRLNLLTPRHLNQKGKALPLSSAEKRKAKWESLQNKQILVPELCAIHPIPASLWRKAVCLPSILYRLH
Form Liquid
Recomended Dilution Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (1:200-1:500)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human DICER1.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 23405
Iso type IgG

Enviar uma mensagem


DICER1 polyclonal antibody

DICER1 polyclonal antibody