ATG10 polyclonal antibody
  • ATG10 polyclonal antibody

ATG10 polyclonal antibody

Ref: AB-PAB30243
ATG10 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant human ATG10.
Información adicional
Size 100 uL
Gene Name ATG10
Gene Alias APG10|APG10L|DKFZp586I0418|FLJ13954|pp12616
Gene Description ATG10 autophagy related 10 homolog (S. cerevisiae)
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P,IF
Immunogen Prot. Seq IGDSWEWRPSKDCSDGYMCKIHFQIKNGSVMSHLGASTHGQTCLPMEEAFELPLDDCEVIETAAASEVIKYEYHVLYSCSYQVPVLYFRASFLDGRPLTLKDIWEGVHECYKM
Form Liquid
Recomended Dilution Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (1:50-1:200)
Immunofluorescence (1-4 ug/mL)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human ATG10.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 83734
Iso type IgG

Enviar uma mensagem


ATG10 polyclonal antibody

ATG10 polyclonal antibody