PSAP polyclonal antibody
  • PSAP polyclonal antibody

PSAP polyclonal antibody

Ref: AB-PAB30237
PSAP polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant human PSAP.
Información adicional
Size 100 uL
Gene Name PSAP
Gene Alias FLJ00245|GLBA|MGC110993|SAP1
Gene Description prosaposin
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,IHC-P,IF
Immunogen Prot. Seq TNSTFVQALVEHVKEECDRLGPGMADICKNYISQYSEIAIQMMMHMQPKEICALVGFCDEVKEMPMQTLVPAKVASKNVIPALELVEPIKKHEVPAKSDVYCEVCEFLVKEVTKLIDNNKTEKEILDAFDKMCSKLPKSLSEE
Form Liquid
Recomended Dilution Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (1:200-1:500)
Immunofluorescence (1-4 ug/mL)
Western Blot (1:100-1:250)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human PSAP.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 5660
Iso type IgG

Enviar uma mensagem


PSAP polyclonal antibody

PSAP polyclonal antibody