SRF polyclonal antibody
  • SRF polyclonal antibody

SRF polyclonal antibody

Ref: AB-PAB30221
SRF polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against partial recombinant human SRF.
Información adicional
Size 100 uL
Gene Name SRF
Gene Alias MCM1
Gene Description serum response factor (c-fos serum response element-binding transcription factor)
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,IHC-P
Immunogen Prot. Seq LPTSFTLMPGGAVAQQVPVQAIQVHQAPQQASPSRDSSTDLTQTSSSGTVTLPATIMTSSVPTTVGGHMMYPSPHAVMYAPTSGLGDGSLTVLNAFSQAPSTMQVSHSQVQEPGGVPQVFLTASSGTVQ
Form Liquid
Recomended Dilution Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (1:50 - 1:200)
Western Blot (1:100 - 1:250)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids 339 - 467 of human SRF.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide).
Gene ID 6722
Iso type IgG

Enviar uma mensagem


SRF polyclonal antibody

SRF polyclonal antibody