LYN polyclonal antibody
  • LYN polyclonal antibody

LYN polyclonal antibody

Ref: AB-PAB30217
LYN polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against partial recombinant human LYN.
Información adicional
Size 100 uL
Gene Name LYN
Gene Alias FLJ26625|JTK8
Gene Description v-yes-1 Yamaguchi sarcoma viral related oncogene homolog
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,WB,IHC-P
Immunogen Prot. Seq KGKDSLSDDGVDLKTQPVRNTERTIYVRDPTSNKQQRPVPESQLLPGQRFQTKDPEEQGDIVVALYPYDGIHPDDLSFKKGEKMKVLEEHGEWWKAKSLLTKKEGFIPSNYVAKLNTLETEEWFFKDITRKDAERQLLAPG
Form Liquid
Recomended Dilution Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (1:200 - 1:500)
Western Blot (1:100 - 1:250)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids 7 - 147 of human LYN.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide).
Gene ID 4067
Iso type IgG

Enviar uma mensagem


LYN polyclonal antibody

LYN polyclonal antibody