CRKL polyclonal antibody
  • CRKL polyclonal antibody

CRKL polyclonal antibody

Ref: AB-PAB30215
CRKL polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against partial recombinant human CRKL.
Información adicional
Size 100 uL
Gene Name CRKL
Gene Alias -
Gene Description v-crk sarcoma virus CT10 oncogene homolog (avian)-like
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,IHC-P
Immunogen Prot. Seq LEYVRTLYDFPGNDAEDLPFKKGEILVIIEKPEEQWWSARNKDGRVGMIPVPYVEKLVRSSPHGKHGNRNSNSYGIPEPAHAYAQPQTTTPLPAVSGSPGAAITPLPSTQNGPVFAKAIQKRVPCAYDKTALALEVGDIVKVTRMNINGQWEGEVNGRKGLFPFTHVKIFDPQNPDE
Form Liquid
Recomended Dilution Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (1:20 - 1:50)
Western Blot (1:100 - 1:250)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids 125 - 301 of human CRKL.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide).
Gene ID 1399
Iso type IgG

Enviar uma mensagem


CRKL polyclonal antibody

CRKL polyclonal antibody